SCOPe 2.01: Domain d3dxme_: 3dxm E:

Lineage for d3dxme_ (3dxm E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
   5 helices; one helix is surrounded by the others

4. Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family)

5. Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)

6. Protein automated matches [190347] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187174] (10 PDB entries)

8. Domain d3dxme_: 3dxm E: [174332]
   Other proteins in same PDB: d3dxmc_, d3dxmf_, d3dxmg_
   automated match to d1k8ke_
   complexed with n24

Details for d3dxme_

PDB Entry: 3dxm, 2.85 Å

PDB Description: Structure of Bos taurus Arp2/3 Complex with Bound Inhibitor CK0993548

PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d3dxme_:

Sequence; same for both SEQRES and ATOM records:

>d3dxme_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

Timeline for d3dxme_:

• d3dxme_ is new in SCOPe 2.01-stable
  
• d3dxme_ appears in SCOPe 2.02
  
• d3dxme_ appears in the current release, SCOPe 2.08