SCOPe 2.08: Domain d3dhta_: 3dht A:

Lineage for d3dhta_ (3dht A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188924] (2 PDB entries)

8. Domain d3dhta_: 3dht A: [173967]
   automated match to d1fhja_
   complexed with hem

Details for d3dhta_

PDB Entry: 3dht, 2.98 Å

PDB Description: the crystal structure determination of rat (rattus norvegicus) hemoglobin

PDB Compounds: (A:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d3dhta_:

Sequence; same for both SEQRES and ATOM records:

>d3dhta_ a.1.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vlsaddktnikncwgkigghggeygeealqrmfaafpttktyfshidvspgsaqvkahgk
kvadalakaadhvedlpgalstlsdlhahklrvdpvnfkflshcllvtlachhpgdftpa
mhasldkflasvstvltsk

Timeline for d3dhta_:

• d3dhta_ first appeared in SCOPe 2.01
  
• d3dhta_ appears in SCOPe 2.07