Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries) |
Domain d3dhrh_: 3dhr H: [173966] automated match to d1fawb_ complexed with hem |
PDB Entry: 3dhr (more details), 2 Å
SCOPe Domain Sequences for d3dhrh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhrh_ a.1.1.2 (H:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]} hwsaeekqlitsiwgkvnvadcgaealarllivypwtqrffssfgnlssataisgnpnvk ahgkkvltsfgdavknldnikgtfaqlselhcdklhvdpenfrllgdilviilaahfgkd ftpecqaawqklvrvvahalarkyh
Timeline for d3dhrh_: