Lineage for d1dqea_ (1dqe A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1088703Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1088704Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
  6. 1088705Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 1088710Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (4 PDB entries)
  8. 1088711Domain d1dqea_: 1dqe A: [17388]
    complexed with bom

Details for d1dqea_

PDB Entry: 1dqe (more details), 1.8 Å

PDB Description: bombyx mori pheromone binding protein
PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d1dqea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqea_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge

SCOPe Domain Coordinates for d1dqea_:

Click to download the PDB-style file with coordinates for d1dqea_.
(The format of our PDB-style files is described here.)

Timeline for d1dqea_: