PDB entry 1dqe

View 1dqe on RCSB PDB site
Description: bombyx mori pheromone binding protein
Class: transport protein
Keywords: helical bundle, transport protein
Deposited on 2000-01-04, released 2001-01-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1dqea_
  • Chain 'B':
    Compound: pheromone-binding protein
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1dqeb_
  • Heterogens: BOM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqeA (A:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqeB (B:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavge