![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
![]() | Protein Dystrophin [47559] (1 species) probably lost calcium-binding function; contains extra helices in each domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47560] (2 PDB entries) |
![]() | Domain d1eg4a1: 1eg4 A:85-209 [17378] Other proteins in same PDB: d1eg4a3 |
PDB Entry: 1eg4 (more details), 2 Å
SCOPe Domain Sequences for d1eg4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eg4a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqp mdilqiinclttiydrleqehnnlvnvplcvdmclnwllnvydtgrtgrirvlsfktgii slcka
Timeline for d1eg4a1: