SCOPe 2.01: Domain d3d5jb_: 3d5j B:

Lineage for d3d5jb_ (3d5j B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (7 PDB entries)

8. Domain d3d5jb_: 3d5j B: [173698]
   automated match to d1ktea_
   complexed with gsw; mutant

Details for d3d5jb_

PDB Entry: 3d5j, 1.91 Å

PDB Description: structure of yeast grx2-c30s mutant with glutathionyl mixed disulfide

PDB Compounds: (B:) Glutaredoxin-2, mitochondrial

SCOPe Domain Sequences for d3d5jb_:

Sequence; same for both SEQRES and ATOM records:

>d3d5jb_ c.47.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vsqetvahvkdligqkevfvaaktycpyskatlstlfqelnvpkskalvleldemsngse
iqdaleeisgqktvpnvyingkhiggnsdletlkkngklaeilkpvf

Timeline for d3d5jb_:

• d3d5jb_ is new in SCOPe 2.01-stable
  
• d3d5jb_ appears in SCOPe 2.02
  
• d3d5jb_ appears in the current release, SCOPe 2.08