Lineage for d3cura_ (3cur A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249152Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2249153Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2249154Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2249184Protein automated matches [190110] (7 species)
    not a true protein
  7. 2249221Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)
  8. 2249243Domain d3cura_: 3cur A: [173472]
    Other proteins in same PDB: d3curh_, d3curi_, d3curj_
    automated match to d1frfs_
    complexed with f3s, fco, gol, mg, ni, per, sf4; mutant

Details for d3cura_

PDB Entry: 3cur (more details), 2.4 Å

PDB Description: Structure of a double methionine mutant of NI-FE hydrogenase
PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d3cura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cura_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d3cura_:

Click to download the PDB-style file with coordinates for d3cura_.
(The format of our PDB-style files is described here.)

Timeline for d3cura_: