Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
Protein automated matches [190110] (7 species) not a true protein |
Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries) |
Domain d3cura_: 3cur A: [173472] Other proteins in same PDB: d3curh_, d3curi_, d3curj_ automated match to d1frfs_ complexed with f3s, fco, gol, mg, ni, per, sf4; mutant |
PDB Entry: 3cur (more details), 2.4 Å
SCOPe Domain Sequences for d3cura_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cura_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]} akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag hpclgcsepdfwdtmtpfyeqg
Timeline for d3cura_: