Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
Protein Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) [47548] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47549] (11 PDB entries) |
Domain d1djha1: 1djh A:200-298 [17346] Other proteins in same PDB: d1djha2, d1djha3, d1djhb2, d1djhb3 complexed with act, ba |
PDB Entry: 1djh (more details), 2.5 Å
SCOPe Domain Sequences for d1djha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djha1 a.39.1.7 (A:200-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Norway rat (Rattus norvegicus) [TaxId: 10116]} eietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslierye psetakaqrqmtkdgflmyllsadgnafslahrrvyqdm
Timeline for d1djha1: