SCOPe 2.05: Domain d1reca_: 1rec A:

Lineage for d1reca_ (1rec A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Recoverin [47533] (1 species)
   Calcium-myristoyl switch; only one EF-hand is functional

7. Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)

8. Domain d1reca_: 1rec A: [17326]
   complexed with ca

Details for d1reca_

PDB Entry: 1rec, 1.9 Å

PDB Description: three-dimensional structure of recoverin, a calcium sensor in vision

PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d1reca_:

Sequence, based on SEQRES records:

>d1reca_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
epqkvkeklk

Sequence, based on observed residues (ATOM records):

>d1reca_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivtaifkmi
spedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqfepqkv
keklk

Timeline for d1reca_:

• d1reca_ first appeared (with stable ids) in SCOP 1.55, called d1rec__
  
• d1reca_ appears in SCOPe 2.04
  
• d1reca_ appears in SCOPe 2.06
  
• d1reca_ appears in the current release, SCOPe 2.08