Lineage for d1reca_ (1rec A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1490302Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 1490303Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)
  8. 1490308Domain d1reca_: 1rec A: [17326]
    complexed with ca

Details for d1reca_

PDB Entry: 1rec (more details), 1.9 Å

PDB Description: three-dimensional structure of recoverin, a calcium sensor in vision
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d1reca_:

Sequence, based on SEQRES records: (download)

>d1reca_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
epqkvkeklk

Sequence, based on observed residues (ATOM records): (download)

>d1reca_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivtaifkmi
spedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqfepqkv
keklk

SCOPe Domain Coordinates for d1reca_:

Click to download the PDB-style file with coordinates for d1reca_.
(The format of our PDB-style files is described here.)

Timeline for d1reca_: