SCOPe 2.05: Domain d3cckb_: 3cck B:

Lineage for d3cckb_ (3cck B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)

8. Domain d3cckb_: 3cck B: [173140]
   automated match to d1fm5a_
   complexed with cl

Details for d3cckb_

PDB Entry: 3cck, 1.8 Å

PDB Description: Human CD69

PDB Compounds: (B:) early activation antigen cd69

SCOPe Domain Sequences for d3cckb_:

Sequence; same for both SEQRES and ATOM records:

>d3cckb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

Timeline for d3cckb_:

• d3cckb_ first appeared in SCOPe 2.01
  
• d3cckb_ appears in SCOPe 2.04
  
• d3cckb_ appears in SCOPe 2.06
  
• d3cckb_ appears in the current release, SCOPe 2.08