SCOPe 2.06: Domain d3cbxb1: 3cbx B:264-364

Lineage for d3cbxb1 (3cbx B:264-364)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)

8. Domain d3cbxb1: 3cbx B:264-364 [173123]
   Other proteins in same PDB: d3cbxa2, d3cbxb2
   automated match to d1l6oa_
   complexed with cl, mpd

Details for d3cbxb1

PDB Entry: 3cbx, 1.7 Å

PDB Description: the dvl2 pdz domain in complex with the c1 inhibitory peptide

PDB Compounds: (B:) Dishevelled-2

SCOPe Domain Sequences for d3cbxb1:

Sequence, based on SEQRES records:

>d3cbxb1 b.36.1.1 (B:264-364) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf

Sequence, based on observed residues (ATOM records):

>d3cbxb1 b.36.1.1 (B:264-364) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnfenm
snddavrvlrdivhkpgpivltvaksgggwkwygwf

Timeline for d3cbxb1:

• d3cbxb1 first appeared in SCOPe 2.01, called d3cbxb_
  
• d3cbxb1 was called d3cbxb_ in SCOPe 2.05
  
• d3cbxb1 appears in SCOPe 2.07
  
• d3cbxb1 appears in the current release, SCOPe 2.08