Lineage for d3bz1o_ (3bz1 O:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058226Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1058227Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 1058258Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 1058264Protein automated matches [191004] (1 species)
    not a true protein
  7. 1058265Species Thermosynechococcus elongatus [TaxId:32046] [188749] (2 PDB entries)
  8. 1058267Domain d3bz1o_: 3bz1 O: [172950]
    Other proteins in same PDB: d3bz1a_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1j_, d3bz1l_, d3bz1m_, d3bz1u_, d3bz1v_
    automated match to d2axto1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1o_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d3bz1o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d3bz1o_:

Click to download the PDB-style file with coordinates for d3bz1o_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1o_: