Lineage for d3bz1a_ (3bz1 A:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060394Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1060395Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1060396Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1060540Protein automated matches [190224] (5 species)
    not a true protein
  7. 1060615Species Thermosynechococcus elongatus [TaxId:32046] [188744] (2 PDB entries)
  8. 1060618Domain d3bz1a_: 3bz1 A: [172942]
    Other proteins in same PDB: d3bz1e_, d3bz1f_, d3bz1h_, d3bz1j_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1u_, d3bz1v_
    automated match to d2axta1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1a_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (A:) Photosystem Q(B) protein

SCOPe Domain Sequences for d3bz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1a_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d3bz1a_:

Click to download the PDB-style file with coordinates for d3bz1a_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1a_: