SCOPe 2.06: Domain d3bq7c1: 3bq7 C:1-68

Lineage for d3bq7c1 (3bq7 C:1-68)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (22 PDB entries)

8. Domain d3bq7c1: 3bq7 C:1-68 [172784]
   Other proteins in same PDB: d3bq7a2, d3bq7c2, d3bq7e2
   automated match to d2f3na1

Details for d3bq7c1

PDB Entry: 3bq7, 2.9 Å

PDB Description: sam domain of diacylglycerol kinase delta1 (e35g)

PDB Compounds: (C:) Diacylglycerol kinase delta

SCOPe Domain Sequences for d3bq7c1:

Sequence; same for both SEQRES and ATOM records:

>d3bq7c1 a.60.1.0 (C:1-68) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvhlwgteevaawlehlslceykdiftrhdirgsgllhlerrdlkdlgvtkvghmkrilc
gikelsrs

Timeline for d3bq7c1:

• d3bq7c1 first appeared in SCOPe 2.01, called d3bq7c_
  
• d3bq7c1 was called d3bq7c_ in SCOPe 2.05
  
• d3bq7c1 appears in SCOPe 2.07
  
• d3bq7c1 appears in the current release, SCOPe 2.08