Lineage for d2f3na1 (2f3n A:2-65)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001089Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2001134Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2001187Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species)
  7. 2001188Species Norway rat (Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries)
    Uniprot Q9JLU4 1749-1815
  8. 2001189Domain d2f3na1: 2f3n A:2-65 [132885]

Details for d2f3na1

PDB Entry: 2f3n (more details), 2.1 Å

PDB Description: crystal structure of the native shank sam domain.
PDB Compounds: (A:) SH3 and multiple ankyrin repeat domains 3

SCOPe Domain Sequences for d2f3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
lrql

SCOPe Domain Coordinates for d2f3na1:

Click to download the PDB-style file with coordinates for d2f3na1.
(The format of our PDB-style files is described here.)

Timeline for d2f3na1: