SCOPe 2.06: Domain d1ej3b_: 1ej3 B:

Lineage for d1ej3b_ (1ej3 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium-regulated photoprotein [47512] (4 species)
   structurally most similar to sarcoplasmic calcium-binding protein

7. Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (1 PDB entry)

8. Domain d1ej3b_: 1ej3 B: [17260]
   complexed with czh

Details for d1ej3b_

PDB Entry: 1ej3, 2.3 Å

PDB Description: crystal structure of aequorin

PDB Compounds: (B:) aequorin

SCOPe Domain Sequences for d1ej3b_:

Sequence; same for both SEQRES and ATOM records:

>d1ej3b_ a.39.1.5 (B:) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

Timeline for d1ej3b_:

• d1ej3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ej3b_ appears in SCOPe 2.05
  
• d1ej3b_ appears in SCOPe 2.07
  
• d1ej3b_ appears in the current release, SCOPe 2.08