Lineage for d1ej3b_ (1ej3 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3289Protein Aequorin [47512] (1 species)
  7. 3290Species Jellyfish (Aequorea aequorea) [47513] (1 PDB entry)
  8. 3292Domain d1ej3b_: 1ej3 B: [17260]

Details for d1ej3b_

PDB Entry: 1ej3 (more details), 2.3 Å

PDB Description: crystal structure of aequorin

SCOP Domain Sequences for d1ej3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej3b_ a.39.1.5 (B:) Aequorin {Jellyfish (Aequorea aequorea)}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

SCOP Domain Coordinates for d1ej3b_:

Click to download the PDB-style file with coordinates for d1ej3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ej3b_: