Lineage for d3aiaa_ (3aia A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884654Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1884655Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1884797Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 1884798Protein automated matches [190961] (13 species)
    not a true protein
  7. 1884835Species Methanocaldococcus jannaschii [TaxId:2190] [189685] (2 PDB entries)
  8. 1884836Domain d3aiaa_: 3aia A: [172204]
    automated match to d2qmma1
    complexed with pbl, sam

Details for d3aiaa_

PDB Entry: 3aia (more details), 1.4 Å

PDB Description: Crystal structure of DUF358 reveals a putative SPOUT-class methltransferase
PDB Compounds: (A:) UPF0217 protein MJ1640

SCOPe Domain Sequences for d3aiaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aiaa_ c.116.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mrefifkanktitssdinlkdlpgscgrldllcrcvsdafflshdirrdvvfyavlygqp
nppvcikfvgselkkvspderniaifikkalkkfeeldeeqrkdwnqstpgiyvrrlgfr
nlvlekleegkniyylhmngedvenvdienpvfiigdhigigeederfldeikakrisls
plelhanhcitiihnvldkk

SCOPe Domain Coordinates for d3aiaa_:

Click to download the PDB-style file with coordinates for d3aiaa_.
(The format of our PDB-style files is described here.)

Timeline for d3aiaa_: