Lineage for d1bt6b_ (1bt6 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710202Species Human (Homo sapiens), P11 s100a10, calpactin [TaxId:9606] [47484] (2 PDB entries)
    ligand of annexin II
  8. 2710206Domain d1bt6b_: 1bt6 B: [17179]

Details for d1bt6b_

PDB Entry: 1bt6 (more details), 2.4 Å

PDB Description: p11 (s100a10), ligand of annexin ii in complex with annexin ii n-terminus
PDB Compounds: (B:) s100a10

SCOPe Domain Sequences for d1bt6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bt6b_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}
psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
crdgkvgfqsffsliagltiacndyfvvhmk

SCOPe Domain Coordinates for d1bt6b_:

Click to download the PDB-style file with coordinates for d1bt6b_.
(The format of our PDB-style files is described here.)

Timeline for d1bt6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bt6a_