SCOPe 2.02: Domain d2zxxb_: 2zxx B:

Lineage for d2zxxb_ (2zxx B:)

1. Root: SCOPe 2.02

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (1 family)

5. Family h.1.28.1: Geminin coiled-coil domain [111470] (1 protein)

6. Protein Geminin coiled-coil domain [111471] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
   Uniprot O88513 79-156

8. Domain d2zxxb_: 2zxx B: [171597]
   Other proteins in same PDB: d2zxxc_, d2zxxf_
   protein/DNA complex

Details for d2zxxb_

PDB Entry: 2zxx, 2.8 Å

PDB Description: Crystal structure of Cdt1/geminin complex

PDB Compounds: (B:) Geminin

SCOPe Domain Sequences for d2zxxb_:

Sequence; same for both SEQRES and ATOM records:

>d2zxxb_ h.1.28.1 (B:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
aevaehvqymaevierls

Timeline for d2zxxb_:

• d2zxxb_ first appeared in SCOPe 2.01
  
• d2zxxb_ appears in SCOPe 2.03
  
• d2zxxb_ appears in the current release, SCOPe 2.08