Lineage for d2zxxa_ (2zxx A:)

  1. Root: SCOPe 2.02
  2. 1246834Class h: Coiled coil proteins [57942] (7 folds)
  3. 1246835Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1247849Superfamily h.1.28: Geminin coiled-coil domain [111469] (1 family) (S)
  5. 1247850Family h.1.28.1: Geminin coiled-coil domain [111470] (1 protein)
  6. 1247851Protein Geminin coiled-coil domain [111471] (2 species)
  7. 1247857Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
    Uniprot O88513 79-156
  8. 1247858Domain d2zxxa_: 2zxx A: [171596]
    Other proteins in same PDB: d2zxxc_, d2zxxf_
    protein/DNA complex

Details for d2zxxa_

PDB Entry: 2zxx (more details), 2.8 Å

PDB Description: Crystal structure of Cdt1/geminin complex
PDB Compounds: (A:) Geminin

SCOPe Domain Sequences for d2zxxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxxa_ h.1.28.1 (A:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
kenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqy
maevierlsn

SCOPe Domain Coordinates for d2zxxa_:

Click to download the PDB-style file with coordinates for d2zxxa_.
(The format of our PDB-style files is described here.)

Timeline for d2zxxa_: