Lineage for d2zxww_ (2zxw W:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578218Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 2578219Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 protein domains)
  6. 2578220Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2578221Species Cow (Bos taurus) [TaxId:9913] [81416] (37 PDB entries)
  8. 2578267Domain d2zxww_: 2zxw W: [171592]
    Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwb2, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1ocrj_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxww_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (W:) Cytochrome c oxidase polypeptide 7A1

SCOPe Domain Sequences for d2zxww_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxww_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfph

SCOPe Domain Coordinates for d2zxww_:

Click to download the PDB-style file with coordinates for d2zxww_.
(The format of our PDB-style files is described here.)

Timeline for d2zxww_: