Lineage for d2zxwc_ (2zxw C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579677Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2579678Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 2579679Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2579692Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2579693Species Cow (Bos taurus) [TaxId:9913] [81444] (48 PDB entries)
  8. 2579740Domain d2zxwc_: 2zxw C: [171573]
    Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwb2, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1occc_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwc_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d2zxwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d2zxwc_:

Click to download the PDB-style file with coordinates for d2zxwc_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwc_: