Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (35 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188265] (1 PDB entry) |
Domain d2yzhd_: 2yzh D: [170943] automated match to d1psqa_ complexed with so4 |
PDB Entry: 2yzh (more details), 1.85 Å
SCOPe Domain Sequences for d2yzhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yzhd_ c.47.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]} ghmartvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldt pvcetetkkfneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekyg vligegalkgilaravfiidkegkvayvqlvpeiteepnydevvnkvkeli
Timeline for d2yzhd_: