![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
![]() | Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries) |
![]() | Domain d2y69i_: 2y69 I: [170640] Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69w_, d2y69x_, d2y69y_, d2y69z_ automated match to d1occi_ complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee mrkagifqsak
Timeline for d2y69i_:
![]() Domains from other chains: (mouse over for more information) d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_ |