Lineage for d2y69z_ (2y69 Z:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578452Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 2578453Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 protein domains)
  6. 2578491Protein automated matches [190273] (1 species)
    not a true protein
  7. 2578492Species Cow (Bos taurus) [TaxId:9913] [187065] (19 PDB entries)
  8. 2578519Domain d2y69z_: 2y69 Z: [239033]
    Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_
    automated match to d1v54m_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69z_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (Z:) cytochrome c oxidase polypeptide 8h

SCOPe Domain Sequences for d2y69z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69z_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykk

SCOPe Domain Coordinates for d2y69z_:

Click to download the PDB-style file with coordinates for d2y69z_.
(The format of our PDB-style files is described here.)

Timeline for d2y69z_: