Lineage for d2xvpb_ (2xvp B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146973Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1146974Protein automated matches [190075] (30 species)
    not a true protein
  7. 1146987Species Aspergillus fumigatus [TaxId:451804] [189778] (2 PDB entries)
  8. 1146989Domain d2xvpb_: 2xvp B: [170429]
    automated match to d1hvqa_
    complexed with po4

Details for d2xvpb_

PDB Entry: 2xvp (more details), 2 Å

PDB Description: chia1 from aspergillus fumigatus, apostructure
PDB Compounds: (B:) class III chitinase chia1

SCOPe Domain Sequences for d2xvpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvpb_ c.1.8.0 (B:) automated matches {Aspergillus fumigatus [TaxId: 451804]}
fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
adhmkdillh

SCOPe Domain Coordinates for d2xvpb_:

Click to download the PDB-style file with coordinates for d2xvpb_.
(The format of our PDB-style files is described here.)

Timeline for d2xvpb_: