SCOPe 2.05: Domain d2xjla_: 2xjl A:

Lineage for d2xjla_ (2xjl A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189462] (4 PDB entries)

8. Domain d2xjla_: 2xjl A: [170133]
   automated match to d1ba9a_
   complexed with act, na, peg, zn

Details for d2xjla_

PDB Entry: 2xjl, 1.55 Å

PDB Description: monomeric human cu,zn superoxide dismutase without cu ligands

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2xjla_:

Sequence; same for both SEQRES and ATOM records:

>d2xjla_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfsvseeedntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvs
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d2xjla_:

• d2xjla_ first appeared in SCOPe 2.01
  
• d2xjla_ appears in SCOPe 2.04
  
• d2xjla_ appears in SCOPe 2.06
  
• d2xjla_ appears in the current release, SCOPe 2.08