Class a: All alpha proteins [46456] (284 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein automated matches [190089] (4 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [187116] (14 PDB entries) |
Domain d2xi6a_: 2xi6 A: [170110] automated match to d1oafa_ complexed with hem, k, so4 |
PDB Entry: 2xi6 (more details), 1.65 Å
SCOPe Domain Sequences for d2xi6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xi6a_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]} gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk lselgfada
Timeline for d2xi6a_: