Lineage for d2xi6a_ (2xi6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720367Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)
  8. 2720379Domain d2xi6a_: 2xi6 A: [170110]
    automated match to d1oafa_
    complexed with hem, k, so4

Details for d2xi6a_

PDB Entry: 2xi6 (more details), 1.65 Å

PDB Description: the structure of ascorbate peroxidase compound i
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d2xi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xi6a_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d2xi6a_:

Click to download the PDB-style file with coordinates for d2xi6a_.
(The format of our PDB-style files is described here.)

Timeline for d2xi6a_: