Class a: All alpha proteins [46456] (285 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (5 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189702] (1 PDB entry) |
Domain d2xhsa_: 2xhs A: [170097] automated match to d1pk5a_ |
PDB Entry: 2xhs (more details), 2.8 Å
SCOPe Domain Sequences for d2xhsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xhsa_ a.123.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gshmledplrvspmirefvqsiddrewqtqlfallqkqtynqvevdlfelmckvldqnlf sqvdwarntvffkdlkvddqmkllqhswsdmlvldhlhhrihnglpdetqlnngqvfnlm slgllgvpqlgdyfnelqnklqdlkfdmgdyvcmkflillnpsvrgivnrktvseghdnv qaalldytltcypsvndkfrglvnilpeihamavrgedhlytkhcagsaptqtllmemlh akrk
Timeline for d2xhsa_: