Lineage for d2xhsa_ (2xhs A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1281320Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1281321Protein automated matches [191142] (4 species)
    not a true protein
  7. 1281329Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189702] (1 PDB entry)
  8. 1281330Domain d2xhsa_: 2xhs A: [170097]
    automated match to d1pk5a_

Details for d2xhsa_

PDB Entry: 2xhs (more details), 2.8 Å

PDB Description: crystal structure of the ligand binding domain of fushi tarazu factor 1 of drosophila melanogaster.
PDB Compounds: (A:) nuclear hormone receptor ftz-f1

SCOPe Domain Sequences for d2xhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhsa_ a.123.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gshmledplrvspmirefvqsiddrewqtqlfallqkqtynqvevdlfelmckvldqnlf
sqvdwarntvffkdlkvddqmkllqhswsdmlvldhlhhrihnglpdetqlnngqvfnlm
slgllgvpqlgdyfnelqnklqdlkfdmgdyvcmkflillnpsvrgivnrktvseghdnv
qaalldytltcypsvndkfrglvnilpeihamavrgedhlytkhcagsaptqtllmemlh
akrk

SCOPe Domain Coordinates for d2xhsa_:

Click to download the PDB-style file with coordinates for d2xhsa_.
(The format of our PDB-style files is described here.)

Timeline for d2xhsa_: