Lineage for d2x7za_ (2x7z A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056646Protein automated matches [190055] (7 species)
    not a true protein
  7. 2056663Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)
  8. 2056693Domain d2x7za_: 2x7z A: [169928]
    automated match to d1qlca_
    complexed with imd, nh4; mutant

Details for d2x7za_

PDB Entry: 2x7z (more details), 2 Å

PDB Description: crystal structure of the sap97 pdz2 i342w c378a mutant protein domain
PDB Compounds: (A:) Disks large homolog 1

SCOPe Domain Sequences for d2x7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x7za_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gskpvsekimeiklikgpkglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqig
dkllavnnvaleevtheeavtalkntsdfvylkvakpts

SCOPe Domain Coordinates for d2x7za_:

Click to download the PDB-style file with coordinates for d2x7za_.
(The format of our PDB-style files is described here.)

Timeline for d2x7za_: