Lineage for d2wufa_ (2wuf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902545Species Mycobacterium tuberculosis [TaxId:83332] [189096] (13 PDB entries)
  8. 2902556Domain d2wufa_: 2wuf A: [169642]
    automated match to d2puha1
    complexed with gol, kem, scn; mutant

Details for d2wufa_

PDB Entry: 2wuf (more details), 1.9 Å

PDB Description: crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with 4,9dsha
PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphd

SCOPe Domain Sequences for d2wufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wufa_ c.69.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflg

SCOPe Domain Coordinates for d2wufa_:

Click to download the PDB-style file with coordinates for d2wufa_.
(The format of our PDB-style files is described here.)

Timeline for d2wufa_: