SCOP 1.73: Domain d1e6jp1: 1e6j P:148-220

Lineage for d1e6jp1 (1e6j P:148-220)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (2 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (4 proteins)

6. Protein HIV capsid protein, dimerisation domain [47359] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (6 PDB entries)

8. Domain d1e6jp1: 1e6j P:148-220 [16956]
   Other proteins in same PDB: d1e6jh1, d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp2
   mutant

Details for d1e6jp1

PDB Entry: 1e6j, 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

PDB Compounds: (P:) capsid protein p24

SCOP Domain Sequences for d1e6jp1:

Sequence; same for both SEQRES and ATOM records:

>d1e6jp1 a.28.3.1 (P:148-220) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
aatleemmtacqg

Timeline for d1e6jp1:

• d1e6jp1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6jp1 appears in SCOP 1.71
  
• d1e6jp1 appears in SCOP 1.75
  
• d1e6jp1 appears in the current release, SCOPe 2.08