Lineage for d1e6jp1 (1e6j P:148-220)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2830Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
  4. 2866Superfamily a.28.3: Retrovirus capsid protein C-terminal domain [47353] (1 family) (S)
  5. 2867Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (4 proteins)
  6. 2873Protein HIV capsid protein, dimerisation domain [47359] (1 species)
  7. 2874Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (5 PDB entries)
  8. 2878Domain d1e6jp1: 1e6j P:148-220 [16956]
    Other proteins in same PDB: d1e6jh1, d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp2

Details for d1e6jp1

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

SCOP Domain Sequences for d1e6jp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jp1 a.28.3.1 (P:148-220) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
aatleemmtacqg

SCOP Domain Coordinates for d1e6jp1:

Click to download the PDB-style file with coordinates for d1e6jp1.
(The format of our PDB-style files is described here.)

Timeline for d1e6jp1: