![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1e6jl2: 1e6j L:106-210 [21454] Other proteins in same PDB: d1e6jh1, d1e6jh2, d1e6jl1, d1e6jp1, d1e6jp2 part of Fab 13B5 against HIV-1 capsid protein p24 mutant |
PDB Entry: 1e6j (more details), 3 Å
SCOP Domain Sequences for d1e6jl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6jl2 b.1.1.2 (L:106-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d1e6jl2:
![]() Domains from other chains: (mouse over for more information) d1e6jh1, d1e6jh2, d1e6jp1, d1e6jp2 |