SCOPe 2.01: Domain d2wq5a_: 2wq5 A:

Lineage for d2wq5a_ (2wq5 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Indian cobra (Naja naja) [TaxId:35670] [189291] (1 PDB entry)

8. Domain d2wq5a_: 2wq5 A: [169556]
   automated match to d1a3da_
   complexed with ca, miy, so4

Details for d2wq5a_

PDB Entry: 2wq5, 1.65 Å

PDB Description: non-antibiotic properties of tetracyclines: structural basis for inhibition of secretory phospholipase a2.

PDB Compounds: (A:) phospholipase a2, acidic

SCOPe Domain Sequences for d2wq5a_:

Sequence; same for both SEQRES and ATOM records:

>d2wq5a_ a.133.1.2 (A:) automated matches {Indian cobra (Naja naja) [TaxId: 35670]}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekiskc
wpffktysykcsqgtltckggnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

Timeline for d2wq5a_:

• d2wq5a_ is new in SCOPe 2.01-stable
  
• d2wq5a_ appears in SCOPe 2.02
  
• d2wq5a_ appears in the current release, SCOPe 2.08