Lineage for d2wphe_ (2wph E:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701750Protein automated matches [190092] (1 species)
    not a true protein
  7. 1701751Species Human (Homo sapiens) [TaxId:9606] [187310] (66 PDB entries)
  8. 1701773Domain d2wphe_: 2wph E: [169541]
    Other proteins in same PDB: d2wphs_
    automated match to d1rfnb_
    complexed with 1pe, ca; mutant

Details for d2wphe_

PDB Entry: 2wph (more details), 1.5 Å

PDB Description: factor ixa superactive triple mutant
PDB Compounds: (E:) Coagulation factor IXa light chain

SCOPe Domain Sequences for d2wphe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wphe_ g.3.11.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr

SCOPe Domain Coordinates for d2wphe_:

Click to download the PDB-style file with coordinates for d2wphe_.
(The format of our PDB-style files is described here.)

Timeline for d2wphe_: