SCOPe 2.08: Domain d2wphe_: 2wph E:

Lineage for d2wphe_ (2wph E:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries)

8. Domain d2wphe_: 2wph E: [169541]
   Other proteins in same PDB: d2wphs_
   automated match to d1rfnb_
   complexed with 1pe, ca; mutant

Details for d2wphe_

PDB Entry: 2wph, 1.5 Å

PDB Description: factor ixa superactive triple mutant

PDB Compounds: (E:) Coagulation factor IXa light chain

SCOPe Domain Sequences for d2wphe_:

Sequence; same for both SEQRES and ATOM records:

>d2wphe_ g.3.11.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr

Timeline for d2wphe_:

• d2wphe_ first appeared in SCOPe 2.01
  
• d2wphe_ appears in SCOPe 2.07