![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (4 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [189176] (5 PDB entries) |
![]() | Domain d2woba_: 2wob A: [169522] automated match to d1g43a_ complexed with ca |
PDB Entry: 2wob (more details), 2 Å
SCOPe Domain Sequences for d2woba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2woba_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]} asisvsykcgvkdgtkntiratinikntgttpvnlsdikvrywftsdgneqnnfvcdyaa fgtdkvkgivkkiensvpgadtyceisftedagrlapggstgtipfriegaaeydqtddy synsemsddfgdntkitayikdklkygvea
Timeline for d2woba_: