SCOPe 2.01: Domain d2woba_: 2wob A:

Lineage for d2woba_ (2wob A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (3 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (3 PDB entries)

8. Domain d2woba_: 2wob A: [169522]
   automated match to d1g43a_
   complexed with ca

Details for d2woba_

PDB Entry: 2wob, 2 Å

PDB Description: 3b' carbohydrate-binding module from the cel9v glycoside hydrolase from clostridium thermocellum. orthorhombic structure

PDB Compounds: (A:) glycoside hydrolase, family 9

SCOPe Domain Sequences for d2woba_:

Sequence; same for both SEQRES and ATOM records:

>d2woba_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
asisvsykcgvkdgtkntiratinikntgttpvnlsdikvrywftsdgneqnnfvcdyaa
fgtdkvkgivkkiensvpgadtyceisftedagrlapggstgtipfriegaaeydqtddy
synsemsddfgdntkitayikdklkygvea

Timeline for d2woba_:

• d2woba_ is new in SCOPe 2.01-stable
  
• d2woba_ appears in SCOPe 2.02
  
• d2woba_ appears in the current release, SCOPe 2.08, called d2woba1