![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.9: Reprolysin-like [55519] (3 proteins) Pfam PF01421 |
![]() | Protein Snake venom metalloprotease [55520] (7 species) |
![]() | Species Terciopelo (Bothrops asper), bap1 [TaxId:8722] [103127] (5 PDB entries) |
![]() | Domain d2w12a_: 2w12 A: [168996] automated match to d1nd1a_ complexed with gol, wr2, zn |
PDB Entry: 2w12 (more details), 1.46 Å
SCOPe Domain Sequences for d2w12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w12a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr hsvgvvrdhsknnlwvavtmahelghnlgihhdtgscscgakscimasvlskvlsyefsd csqnqyetyltnhnpqcilnkp
Timeline for d2w12a_: