Lineage for d2vywa_ (2vyw A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1256210Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1256211Protein automated matches [190590] (11 species)
    not a true protein
  7. 1256232Species Fasciola hepatica [TaxId:6192] [188561] (1 PDB entry)
  8. 1256233Domain d2vywa_: 2vyw A: [168937]
    automated match to d1h97a_
    complexed with hem, oxy

Details for d2vywa_

PDB Entry: 2vyw (more details), 1.8 Å

PDB Description: hemoglobin (hb2) from trematode fasciola hepatica
PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d2vywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vywa_ a.1.1.0 (A:) automated matches {Fasciola hepatica [TaxId: 6192]}
avltqtqidsiladlahhtdttehitemgvsiyktlfaahpeyisyfsklqgltkdnvgq
segiryygrtlgeelirllkaasnpsvleerivqgakdhkarpvtkdqftgaapifikff
qgllkkqedkdaiekfllhvmqaiaakm

SCOPe Domain Coordinates for d2vywa_:

Click to download the PDB-style file with coordinates for d2vywa_.
(The format of our PDB-style files is described here.)

Timeline for d2vywa_: