Lineage for d1h97a_ (1h97 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255623Protein Trematode hemoglobin/myoglobin [63438] (1 species)
  7. 1255624Species Paramphistomum epiclitum [TaxId:54403] [63439] (2 PDB entries)
  8. 1255625Domain d1h97a_: 1h97 A: [60812]
    complexed with hem, so4

Details for d1h97a_

PDB Entry: 1h97 (more details), 1.17 Å

PDB Description: trematode hemoglobin from paramphistomum epiclitum
PDB Compounds: (A:) globin-3

SCOPe Domain Sequences for d1h97a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}
tltkheqdillkelgphvdtpahivetglgayhalftahpqyishfsrleghtienvmqs
egikhyartlteaivhmlkeisndaevkkiaaqygkdhtsrkvtkdefmsgepiftkyfq
nlvkdaegkaavekflkhvfpmmaaei

SCOPe Domain Coordinates for d1h97a_:

Click to download the PDB-style file with coordinates for d1h97a_.
(The format of our PDB-style files is described here.)

Timeline for d1h97a_: