SCOPe 2.08: Domain d1ilka_: 1ilk A:

Lineage for d1ilka_ (1ilk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Human (Homo sapiens) [TaxId:9606] [47307] (6 PDB entries)

8. Domain d1ilka_: 1ilk A: [16886]

Details for d1ilka_

PDB Entry: 1ilk, 1.8 Å

PDB Description: interleukin-10 crystal structure reveals the functional dimer with an unexpected topological similarity to interferon gamma

PDB Compounds: (A:) interleukin-10

SCOPe Domain Sequences for d1ilka_:

Sequence; same for both SEQRES and ATOM records:

>d1ilka_ a.26.1.3 (A:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]}
nscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemi
qfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafn
klqekgiykamsefdifinyieaymtmkirn

Timeline for d1ilka_:

• d1ilka_ first appeared (with stable ids) in SCOP 1.55, called d1ilk__
  
• d1ilka_ appears in SCOPe 2.07