PDB entry 1ilk

View 1ilk on RCSB PDB site
Description: interleukin-10 crystal structure reveals the functional dimer with an unexpected topological similarity to interferon gamma
Class: cytokine
Keywords: cytokine
Deposited on 1995-04-21, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ilka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilkA (A:)
    nscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemi
    qfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafn
    klqekgiykamsefdifinyieaymtmkirn